Structure of PDB 2wuc Chain A Binding Site BS01

Receptor Information
>2wuc Chain A (length=239) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IIGGSSSLPGSHPWLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDS
VSVVLGQHFFNRTTDVTQTFGIEKYIPYTLYSVFNPSDHDLVLIRLKKKG
DRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWGHLDENVSGYSSSLREA
LVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLACEKN
GVAYLYGIISWGDGCGRLHKPGVYTRVANYVDWINDRIR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wuc Unraveling the Allosteric Mechanism of Serine Protease Inhibition by an Antibody
Resolution2.7 Å
Binding residue
(original residue number in PDB)
S26 W29 R114 Q116 P120 C122 V206 A207 I242 R243
Binding residue
(residue number reindexed from 1)
S11 W14 R106 Q108 P112 C114 V202 A203 I238 R239
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 Q192 G193 D194 S195 G196
Catalytic site (residue number reindexed from 1) H40 D90 Q188 G189 D190 S191 G192
Enzyme Commision number 3.4.21.-
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:2wuc, PDBe:2wuc, PDBj:2wuc
PDBsum2wuc
PubMed20004165
UniProtQ04756|HGFA_HUMAN Hepatocyte growth factor activator (Gene Name=HGFAC)

[Back to BioLiP]