Structure of PDB 2wub Chain A Binding Site BS01

Receptor Information

>2wub Chain A (length=231) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IIGGSSSLPGSHPWLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDS
VSVVLGQHFFNRTTDVTQTFGIEKYIPYTLYSVFNPSDHDLVLIRLKKKG
DRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWGHLDENVSGYSSSLREA
LVPLVADHKCSSPEVYGADISPNMLCAGYFDCACQGDSGGPLACEKNGVA
YLYGIISWGCGKPGVYTRVANYVDWINDRIR

Ligand information

>2wub Chain B (length=6) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ACGRRH

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2wub Unraveling the Allosteric Mechanism of Serine Protease Inhibition by an Antibody
Resolution	2.9 Å
Binding residue (original residue number in PDB)	W29 Q116 P120 I121 C122 E202 A207 I242 R243
Binding residue (residue number reindexed from 1)	W14 Q108 P112 I113 C114 E195 A200 I230 R231

Enzymatic activity

Catalytic site (original residue number in PDB)	H57 D102 Q192 G193 D194 S195 G196
Catalytic site (residue number reindexed from 1)	H40 D90 Q185 G186 D187 S188 G189
Enzyme Commision number	3.4.21.-

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2wub, PDBe:2wub, PDBj:2wub
PDBsum	2wub
PubMed	20004165
UniProt	Q04756\|HGFA_HUMAN Hepatocyte growth factor activator (Gene Name=HGFAC)

[Back to BioLiP]