Structure of PDB 2wty Chain A Binding Site BS01

Receptor Information
>2wty Chain A (length=94) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDDQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQ
QKHHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKSEKLANSG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wty Design of a bZIP Transcription Factor with Homo/Heterodimer-Induced DNA-Binding Preference.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		R249 R256
Binding residue
(residue number reindexed from 1)		R38 R45
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2wty, PDBe:2wty, PDBj:2wty
PDBsum2wty
PubMed24530283
UniProtP54841|MAFB_MOUSE Transcription factor MafB (Gene Name=Mafb)

[Back to BioLiP]