Structure of PDB 2wp2 Chain A Binding Site BS01

Receptor Information
>2wp2 Chain A (length=114) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YINTLTNQLQFLQRVVLKALWKHGFSWPFQQPVDAVKLKLPDYYTIIKTP
MDLNTIKKRLENKYYEKASECIEDFNTMFSNCYLYNKTGDDIVVMAQALE
KLFMQKLSQMPQEE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wp2 Cooperative Binding of Two Acetylation Marks on a Histone Tail by a Single Bromodomain.
Resolution2.37 Å
Binding residue
(original residue number in PDB)
F47 V55 L60 L62 N108 D113 I114 V116 M117
Binding residue
(residue number reindexed from 1)
F25 V33 L38 L40 N86 D91 I92 V94 M95
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2wp2, PDBe:2wp2, PDBj:2wp2
PDBsum2wp2
PubMed19794495
UniProtQ91Y44|BRDT_MOUSE Bromodomain testis-specific protein (Gene Name=Brdt)

[Back to BioLiP]