Structure of PDB 2wp1 Chain A Binding Site BS01

Receptor Information
>2wp1 Chain A (length=123) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QHKVLKTVKVTEQLKHCSEILKEMLAKKHLPYAWPFYNPVDADALGLHNY
YDVVKNPMDLGTIKGKMDNQEYKDAYEFAADVRLMFMNCYKYNPPDHEVV
AMARTLQDVFELHFAKIPDEPIE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wp1 Cooperative Binding of Two Acetylation Marks on a Histone Tail by a Single Bromodomain.
Resolution2.1 Å
Binding residue
(original residue number in PDB)
V298 H306 N307 N351 P352 H355 V357
Binding residue
(residue number reindexed from 1)
V40 H48 N49 N93 P94 H97 V99
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2wp1, PDBe:2wp1, PDBj:2wp1
PDBsum2wp1
PubMed19794495
UniProtQ91Y44|BRDT_MOUSE Bromodomain testis-specific protein (Gene Name=Brdt)

[Back to BioLiP]