Structure of PDB 2wos Chain A Binding Site BS01

Receptor Information
>2wos Chain A (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKG
TNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCS
Ligand information
Ligand IDCA
InChIInChI=1S/Ca/q+2
InChIKeyBHPQYMZQTOCNFJ-UHFFFAOYSA-N
SMILES
SoftwareSMILES
CACTVS 3.341[Ca++]
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Ca+2]
FormulaCa
NameCALCIUM ION
ChEMBL
DrugBankDB14577
ZINC
PDB chain2wos Chain A Residue 1097 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wos Identification and Characterization of Binding Sites on S100A7, a Participant in Cancer and Inflammation Pathways.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		D62 N64 D66 K68 E73
Binding residue
(residue number reindexed from 1)		D62 N64 D66 K68 E73
Annotation score4
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
GO:0046914 transition metal ion binding
GO:0048306 calcium-dependent protein binding
GO:0050786 RAGE receptor binding
GO:0140486 zinc ion sequestering activity
Biological Process
GO:0000302 response to reactive oxygen species
GO:0001525 angiogenesis
GO:0008544 epidermis development
GO:0010820 positive regulation of T cell chemotaxis
GO:0030216 keratinocyte differentiation
GO:0032496 response to lipopolysaccharide
GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:0071624 positive regulation of granulocyte chemotaxis
GO:0090026 positive regulation of monocyte chemotaxis
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005829 cytosol
GO:0005925 focal adhesion
GO:0035578 azurophil granule lumen
GO:0062023 collagen-containing extracellular matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2wos, PDBe:2wos, PDBj:2wos
PDBsum2wos
PubMed19810752
UniProtP31151|S10A7_HUMAN Protein S100-A7 (Gene Name=S100A7)

[Back to BioLiP]