Structure of PDB 2wj8 Chain A Binding Site BS01

Receptor Information
>2wj8 Chain A (length=374) Species: 11260 (Human respiratory syncytial virus A strain Long) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALSKVKLNDTLNKDQLLSSSKYTIQRSTGDSIDTPNYDVQKHINKLCGML
LITEDANHKFTGLIGMLYAMSRLGREDTIKILRDAGYHVKANGVDVTTHR
QDINGKEMKFEVLTLASLTTEIQINIEIESRKSYKKMLKEMGEVAPEYRH
DSPDCGMIILCIAALVITKLAAGDRSGLTAVIRRANNVLKNEMKRYKGLL
PKDIANSFYEVFEKHPHFIDVFVHFGIAQSSTRGGSRVEGIFAGLFMNAY
GAGQVMLRWGVLAKSVKNIMLGHASVQAEMEQVVEVYEYAQKLGGEAGFY
HILNNPKASLLSLTQFPHFSSVVLGNAAGLGIMGEYRGTPRNQDLYDAAK
AYAEQLKENGVINYSVLDLTAEEL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wj8 Crystal Structure of a Nucleocapsid-Like Nucleoprotein-RNA Complex of Respiratory Syncytial Virus
Resolution3.29 Å
Binding residue
(original residue number in PDB)		K170 A172 R184 R185 N249 G254 V256 W260 S313 T315 G335 Y337 R338
Binding residue
(residue number reindexed from 1)		K169 A171 R183 R184 N248 G253 V255 W259 S312 T314 G334 Y336 R337
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030291 protein serine/threonine kinase inhibitor activity
Biological Process
GO:0019049 virus-mediated perturbation of host defense response
GO:0039502 symbiont-mediated suppression of host type I interferon-mediated signaling pathway
GO:0039545 symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of MAVS activity
GO:0039554 symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of MDA-5 activity
GO:0039580 symbiont-mediated suppression of host PKR/eIFalpha signaling
GO:0085034 symbiont-mediated suppression of host NF-kappaB cascade
Cellular Component
GO:0019013 viral nucleocapsid
GO:0019028 viral capsid
GO:0019029 helical viral capsid
GO:0030430 host cell cytoplasm
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2wj8, PDBe:2wj8, PDBj:2wj8
PDBsum2wj8
PubMed19965480
UniProtP03418|NCAP_HRSVA Nucleoprotein (Gene Name=N)

[Back to BioLiP]