Structure of PDB 2wj0 Chain A Binding Site BS01

Receptor Information
>2wj0 Chain A (length=125) Species: 2234 (Archaeoglobus fulgidus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKGTRFERDLLVELWKAGFAAIRVAGSGVSPFPCPDIVAGNGRTYLAIEV
KMRKELPLYLSADEVEQLVTFARGFGAEAYVALKLPRKKWRFFPVQMLER
TEKNFKIDESVYPLGLEIAEVAGKF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wj0 Crystal Structures of Holliday Junction Resolvases from Archaeoglobus Fulgidus Bound to DNA Substrate
Resolution3.1 Å
Binding residue
(original residue number in PDB)		R7 R10 R25
Binding residue
(residue number reindexed from 1)		R5 R8 R23
Enzymatic activity
Enzyme Commision number 3.1.21.10: crossover junction endodeoxyribonuclease.
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0008821 crossover junction DNA endonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0006281 DNA repair
GO:0006310 DNA recombination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2wj0, PDBe:2wj0, PDBj:2wj0
PDBsum2wj0
PubMed
UniProtO28314|HJC_ARCFU Crossover junction endodeoxyribonuclease Hjc (Gene Name=hjc)

[Back to BioLiP]