Structure of PDB 2wiz Chain A Binding Site BS01

Receptor Information
>2wiz Chain A (length=125) Species: 224325 (Archaeoglobus fulgidus DSM 4304) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRFERDLLVELWKAGFAAIRVAGSGVSPFPCPDIVAGNGRTYLAIEVKMR
KELPLYLSADEVEQLVTFARGFGAEAYVALKLPRKKWRFFPVQMLERTEK
NFKIDESVYPLGLEIAEVAGKFFQE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wiz Crystal Structures of Holliday Junction Resolvases from Archaeoglobus Fulgidus Bound to DNA Substrate
Resolution3.3 Å
Binding residue
(original residue number in PDB)
K53 M54 R55 K56
Binding residue
(residue number reindexed from 1)
K48 M49 R50 K51
Enzymatic activity
Enzyme Commision number 3.1.21.10: crossover junction endodeoxyribonuclease.
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0008821 crossover junction DNA endonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0006281 DNA repair
GO:0006310 DNA recombination

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:2wiz, PDBe:2wiz, PDBj:2wiz
PDBsum2wiz
PubMed
UniProtO28314|HJC_ARCFU Crossover junction endodeoxyribonuclease Hjc (Gene Name=hjc)

[Back to BioLiP]