Structure of PDB 2wbu Chain A Binding Site BS01

Receptor Information
>2wbu Chain A (length=85) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
THTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELT
RHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wbu The Structure of the Klf4 DNA-Binding Domain Links to Self-Renewal and Macrophage Differentiation.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y411 K413 H416 R443 R449 K453 R471 H474
Binding residue
(residue number reindexed from 1)		Y13 K15 H18 R45 R51 K55 R73 H76
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2wbu, PDBe:2wbu, PDBj:2wbu
PDBsum2wbu
PubMed21290164
UniProtQ60793|KLF4_MOUSE Krueppel-like factor 4 (Gene Name=Klf4)

[Back to BioLiP]