Structure of PDB 2wa8 Chain A Binding Site BS01

Receptor Information
>2wa8 Chain A (length=88) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQ
GKAICGVFTAEVAETKVAMVNKYARENEHPLLCTLEKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wa8 Structural Basis of N-End Rule Substrate Recognition in Escherichia Coli by the Clpap Adaptor Protein Clps.
Resolution2.15 Å
Binding residue
(original residue number in PDB)
N34 D35 T38 P39 M40 V43 T59 Q60 L63 V65 H66 L99
Binding residue
(residue number reindexed from 1)
N16 D17 T20 P21 M22 V25 T41 Q42 L45 V47 H48 L81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0051087 protein-folding chaperone binding
GO:0140678 molecular function inhibitor activity
Biological Process
GO:0006508 proteolysis
GO:0009408 response to heat
GO:0030163 protein catabolic process

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:2wa8, PDBe:2wa8, PDBj:2wa8
PDBsum2wa8
PubMed19373253
UniProtP0A8Q6|CLPS_ECOLI ATP-dependent Clp protease adapter protein ClpS (Gene Name=clpS)

[Back to BioLiP]