Structure of PDB 2w84 Chain A Binding Site BS01

Receptor Information
>2w84 Chain A (length=57) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ENVLPREPLIATAVKFLQNSRVRQSPLATRRAFLKKKGLTDEEIDMAFQQ
SGTAADE
Ligand information
>2w84 Chain B (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GVADLALSENWAQEFLAAGD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2w84 Structural basis for competitive interactions of Pex14 with the import receptors Pex5 and Pex19.
ResolutionN/A
Binding residue
(original residue number in PDB)		T31 A32 K34 F35 V41 T48 F52 K56
Binding residue
(residue number reindexed from 1)		T12 A13 K15 F16 V22 T29 F33 K37
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0016560 protein import into peroxisome matrix, docking
Cellular Component
GO:0005778 peroxisomal membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2w84, PDBe:2w84, PDBj:2w84
PDBsum2w84
PubMed19197237
UniProtO75381|PEX14_HUMAN Peroxisomal membrane protein PEX14 (Gene Name=PEX14)

[Back to BioLiP]