Structure of PDB 2w7n Chain A Binding Site BS01

Receptor Information
>2w7n Chain A (length=94) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKRLTESQFQEAIQGLEVGQQTIEIARGVLVDGKPQATFATSLGLTRGAV
SQAVHRVWAAFEDKNLPEGYARVTAVLPEHQAYIVRKWEADAKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2w7n Crystal Structure of Kora Bound to Operator DNA: Insight Into Repressor Cooperation in Rp4 Gene Regulation
Resolution1.85 Å
Binding residue
(original residue number in PDB)		E18 V19 G20 Q22 T47 A50 Q53 R57
Binding residue
(residue number reindexed from 1)		E17 V18 G19 Q21 T46 A49 Q52 R56
Binding affinityPDBbind-CN: Kd=23.3nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding

View graph for
Molecular Function
External links
PDB RCSB:2w7n, PDBe:2w7n, PDBj:2w7n
PDBsum2w7n
PubMed19190096
UniProtP03052|KORA2_ECOLX TrfB transcriptional repressor protein (Gene Name=trfB)

[Back to BioLiP]