Structure of PDB 2w65 Chain A Binding Site BS01

Receptor Information
>2w65 Chain A (length=212) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIQLVQSGPELKKPGETVKISCKASGYTFTDYSIHWVKQAPGKGLKWMGW
INTETGEPTYTDDFKGRFAFSLESSASTAFLQINNLKNEDTATYFCARAT
TATELAYWGQGTLVTVSAAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVT
VTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPA
SSTKVDKKIVPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2w65 Structure and pathogenicity of antibodies specific for citrullinated collagen type II in experimental arthritis.
Resolution2.21 Å
Binding residue
(original residue number in PDB)		D31 Y32 S33 W50 N52 T53 E54 E104
Binding residue
(residue number reindexed from 1)		D31 Y32 S33 W50 N52 T53 E54 E104
External links