Structure of PDB 2w3o Chain A Binding Site BS01

Receptor Information
>2w3o Chain A (length=100) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRLWLESPPGEAPPIFLPSDGQALVLGRGPLTQVTDRKCSRTQVELVADP
ETRTVAVKQLGVNPSTTGTQELKPGLEGSLGVGDTLYLVNGEHPLTLRWE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2w3o Specific Recognition of a Multiply Phosphorylated Motif in the DNA Repair Scaffold Xrcc1 by the Fha Domain of Human Pnk.
Resolution1.85 Å
Binding residue
(original residue number in PDB)
R35 G36 P37 Q40 V41 T42 R44 K45 S47 R48 V69 N70 N97
Binding residue
(residue number reindexed from 1)
R28 G29 P30 Q33 V34 T35 R37 K38 S40 R41 V62 N63 N90
Enzymatic activity
Enzyme Commision number 2.7.1.78: polynucleotide 5'-hydroxyl-kinase.
3.1.3.32: polynucleotide 3'-phosphatase.
External links
PDB RCSB:2w3o, PDBe:2w3o, PDBj:2w3o
PDBsum2w3o
PubMed19155274
UniProtQ96T60|PNKP_HUMAN Bifunctional polynucleotide phosphatase/kinase (Gene Name=PNKP)

[Back to BioLiP]