Structure of PDB 2w2u Chain A Binding Site BS01

Receptor Information
>2w2u Chain A (length=75) Species: 2285 (Sulfolobus acidocaldarius) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSAQVMLEEMARKYAINAVKADKEGNAEEAITNYKKAIEVLAQLVSLYRD
GSTAAIYEQMINEYKRRIEVLKELI
Ligand information
>2w2u Chain C (length=11) Species: 2285 (Sulfolobus acidocaldarius) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RELLPELPHPP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2w2u A Role for the Escrt System in Cell Division in Archaea.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		E8 R12 A15 D22 Y34 S52 T53 M60 E63 Y64 R67
Binding residue
(residue number reindexed from 1)		E8 R12 A15 D22 Y34 S52 T53 M60 E63 Y64 R67
Enzymatic activity
Enzyme Commision number ?
External links