Structure of PDB 2w2h Chain A Binding Site BS01

Receptor Information
>2w2h Chain A (length=263) Species: 9796 (Equus caballus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKNNNKRWYFTREQLENSPSRRFGLDPDKELSYRQQAANLLQDMGQRLNV
SQLTINTAIVYMHRFYMIQSFTRFHRNSVAPAALFLAAKVEEQPKKLEHV
IKVAHTCLHPQESLPDTRSEAYLQQVQDLVILESIILQTLGFELTIDHPH
THVVKCTQLVRASKDLAQTSYFMATNSLHLTTFSLQYTPPVVACVCIHLA
CKWSNWEIPVSTDGKHWWEYVDATVTLELLDELTHEFLQILEKTPNRLKR
IWNWRACQAAKKT
Ligand information
>2w2h Chain C (length=29) Species: 11665 (Equine infectious anemia virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IDYLDASLRKKNKQRLKAIQQGRQPQYLL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2w2h Structural Insights Into the Cyclin T1-Tat-Tar RNA Transcription Activation Complex from Eiav.
Resolution3.25 Å
Binding residue
(original residue number in PDB)		Q40 N43 L44 D47 A108 H109 C111 L112 H113 Q115 E116 Q129 R251 K253
Binding residue
(residue number reindexed from 1)		Q36 N39 L40 D43 A104 H105 C107 L108 H109 Q111 E112 Q125 R247 K249
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0016538 cyclin-dependent protein serine/threonine kinase regulator activity
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2w2h, PDBe:2w2h, PDBj:2w2h
PDBsum2w2h
PubMed19029897
UniProtQ9XT26|CCNT1_HORSE Cyclin-T1 (Gene Name=CCNT1)

[Back to BioLiP]