Structure of PDB 2vzd Chain A Binding Site BS01

Receptor Information
>2vzd Chain A (length=127) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVY
LVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPR
PEDIVNCDLKSTLRVLYNLFTKYRNVE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2vzd Structural Analysis of the Interactions between Paxillin Ld Motifs and Alpha-Parvin
Resolution2.1 Å
Binding residue
(original residue number in PDB)		A249 K260 V263 V264 T267 Y362 F365 R369
Binding residue
(residue number reindexed from 1)		A4 K15 V18 V19 T22 Y117 F120 R124
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0007155 cell adhesion
GO:0030036 actin cytoskeleton organization

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2vzd, PDBe:2vzd, PDBj:2vzd
PDBsum2vzd
PubMed18940607
UniProtQ9NVD7|PARVA_HUMAN Alpha-parvin (Gene Name=PARVA)

[Back to BioLiP]