Structure of PDB 2vz4 Chain A Binding Site BS01

Receptor Information
>2vz4 Chain A (length=100) Species: 1916 (Streptomyces lividans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYSVGQVAGFAGVTVRTLHHYDDIGLLVPSERSHAGHRRYSDADLDRLQQ
ILFYRELGFPLDEVAALLDDRAHLRRQHELLSARIGKLQKMAAAVEQAME
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2vz4 Structure of the Transcriptionally Inactive Merr Domain Tipan in Complex with DNA
Resolution2.9 Å
Binding residue
(original residue number in PDB)		S4 V5 G6 H20 H38 R39
Binding residue
(residue number reindexed from 1)		S3 V4 G5 H19 H37 R38
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2vz4, PDBe:2vz4, PDBj:2vz4
PDBsum2vz4
PubMed
UniProtP0A4T9|TIPA_STRLI HTH-type transcriptional activator TipA (Gene Name=tipA)

[Back to BioLiP]