Structure of PDB 2vy2 Chain A Binding Site BS01

Receptor Information
>2vy2 Chain A (length=163) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
REHPFIVTEPGEVARGKKNGLDYLFHLYEQCREFLLQVQTIAKDRGEKCP
TKVTNQVFRYAKKSGASYINKPKMRHYVHCYALHCLDEEASNALRRAFKE
RGENVGSWRQACYKPLVNIACRHGWDIDAVFNAHPRLSIWYVPTKLRQLC
HLERNNAVAAAAA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2vy2 Structural Basis for Leafy Floral Switch Function and Similarity with Helix-Turn-Helix Proteins.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		T290 N291 R295 K307 Y377 T380
Binding residue
(residue number reindexed from 1)		T54 N55 R59 K71 Y141 T144
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2vy2, PDBe:2vy2, PDBj:2vy2
PDBsum2vy2
PubMed18784751
UniProtQ00958|LFY_ARATH Protein LEAFY (Gene Name=LFY)

[Back to BioLiP]