Structure of PDB 2vs8 Chain A Binding Site BS01

Receptor Information
>2vs8 Chain A (length=183) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ENVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKSENLIKQHIAP
LMQFLIDELNVKSKIQIVKGDTRYELRVSSKKLYYYFANMLERIRLFNMR
EQIAFIKGLYVAEGDKTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLD
DHRHGVYVLNISLRDRIKFVHTILSSHLNPLPP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2vs8 Crystal Structure of I-Dmoi in Complex with its Target DNA Provides New Insights Into Meganuclease Engineering.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		D21 T41 Q42 K43 T76 R77 R124 T150 H152 D154 R157 S166 L167
Binding residue
(residue number reindexed from 1)		D17 T37 Q38 K39 T72 R73 R120 T146 H148 D150 R153 S162 L163
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing
GO:0016539 intein-mediated protein splicing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2vs8, PDBe:2vs8, PDBj:2vs8
PDBsum2vs8
PubMed18974222
UniProtP21505|DMO1_DESMO Homing endonuclease I-DmoI

[Back to BioLiP]