Structure of PDB 2vs7 Chain A Binding Site BS01

Receptor Information
>2vs7 Chain A (length=179) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NENVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKSENLIKQHIA
PLMQFLIDELNVKSKIQIVKGDTRYELRVSSKKLYYYFANMLERIRLFNM
REQIAFIKGLYVAEGDKTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHL
DDHRHGVYVLNISLRDRIKFVHTILSSHL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2vs7 Crystal Structure of I-Dmoi in Complex with its Target DNA Provides New Insights Into Meganuclease Engineering.
Resolution2.05 Å
Binding residue
(original residue number in PDB)		G20 D21 G22 Y25 Y29 R33 R37 T41 Q42 K43 T76 R77 E117 R124 H152 D154 R157 N164 S166 L167
Binding residue
(residue number reindexed from 1)		G17 D18 G19 Y22 Y26 R30 R34 T38 Q39 K40 T73 R74 E114 R121 H149 D151 R154 N161 S163 L164
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing
GO:0016539 intein-mediated protein splicing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2vs7, PDBe:2vs7, PDBj:2vs7
PDBsum2vs7
PubMed18974222
UniProtP21505|DMO1_DESMO Homing endonuclease I-DmoI

[Back to BioLiP]