Structure of PDB 2vpe Chain A Binding Site BS01

Receptor Information
>2vpe Chain A (length=61) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAVYPCGICTNEVNDDQDAILCEASCQKWFHRICTGMTETAYGLLTAEAS
AVWGCDTCMAD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2vpe Decoding of Methylated Histone H3 Tail by the Pygo- Bcl9 Wnt Signaling Complex.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		D352 Q354 A356 I357 L358 E360 W366 Y379 L382 T383 A388
Binding residue
(residue number reindexed from 1)		D15 Q17 A19 I20 L21 E23 W29 Y42 L45 T46 A51
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2vpe, PDBe:2vpe, PDBj:2vpe
PDBsum2vpe
PubMed18498752
UniProtQ9Y3Y4|PYGO1_HUMAN Pygopus homolog 1 (Gene Name=PYGO1)

[Back to BioLiP]