Structure of PDB 2voh Chain A Binding Site BS01

Receptor Information
>2voh Chain A (length=155) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSMAESELMHIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQ
KEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAF
GGVLLKKLKQEQIALDVSAYKQVSSFVAEFIMNNTGEWIRQNGGWEDGFI
KKFEP
Ligand information
>2voh Chain B (length=24) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PNSILGQVGRQLALIGDDINRRYD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2voh Structural Plasticity Underpins Promiscuous Binding of the Prosurvival Protein A1.
Resolution1.9 Å
Binding residue
(original residue number in PDB)
E47 L52 Y55 F59 Q73 V74 K77 E78 N85 G87 R88 T91 F95 K147 F148
Binding residue
(residue number reindexed from 1)
E52 L57 Y60 F64 Q78 V79 K82 E83 N90 G92 R93 T96 F100 K152 F153
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process
GO:0043066 negative regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:2voh, PDBe:2voh, PDBj:2voh
PDBsum2voh
PubMed18462686
UniProtQ07440|B2LA1_MOUSE Bcl-2-related protein A1 (Gene Name=Bcl2a1)

[Back to BioLiP]