Structure of PDB 2vof Chain A Binding Site BS01

Receptor Information
>2vof Chain A (length=145) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSMAESELMHIHSLAEHYLQYVLQVPAFEAPSQACRVLQRVAFSVQKEVE
KNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVL
LKKLKQESAYKQVSSFVAEFIMNNTGEWIRQNGGWEDGFIKKFEP
Ligand information
>2vof Chain B (length=23) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EEWAREIGAQLRRIADDLNAQYE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2vof Structural Plasticity Underpins Promiscuous Binding of the Prosurvival Protein A1.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		L52 Y55 F59 Q73 V74 K77 E78 E80 D81 N85 G87 R88 T91 F95 K147 F148
Binding residue
(residue number reindexed from 1)		L53 Y56 F60 Q74 V75 K78 E79 E81 D82 N86 G88 R89 T92 F96 K142 F143
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process
GO:0043066 negative regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:2vof, PDBe:2vof, PDBj:2vof
PDBsum2vof
PubMed18462686
UniProtQ07440|B2LA1_MOUSE Bcl-2-related protein A1 (Gene Name=Bcl2a1)

[Back to BioLiP]