Structure of PDB 2vnf Chain A Binding Site BS01

Receptor Information
>2vnf Chain A (length=50) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2vnf Molecular Basis of Histone H3K4Me3 Recognition by Ing4
Resolution1.76 Å
Binding residue
(original residue number in PDB)		Y198 S205 Y206 G207 E208 M209 I210 G211 C212 D213 W221 K232 P233 G235
Binding residue
(residue number reindexed from 1)		Y4 S11 Y12 G13 E14 M15 I16 G17 C18 D19 W27 K38 P39 G41
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2vnf, PDBe:2vnf, PDBj:2vnf
PDBsum2vnf
PubMed18381289
UniProtQ9UNL4|ING4_HUMAN Inhibitor of growth protein 4 (Gene Name=ING4)

[Back to BioLiP]