Structure of PDB 2vm6 Chain A Binding Site BS01

Receptor Information
>2vm6 Chain A (length=144) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMTDCEFGYIYRLAQDYLQCVLQIPSKTSRVLQNVAFSVQKEVEKNLKSC
LDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLR
QQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFE
Ligand information
>2vm6 Chain B (length=25) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DMRPEIWIAQELRRIGDEFNAYYAR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2vm6 Completing the Family Portrait of the Anti- Apoptotic Bcl-2 Proteins: Crystal Structure of Human Bfl-1 in Complex with Bim.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		V44 E47 N51 L52 C55 Q73 V74 K77 E78 D81 N85 G87 R88 T91 F95 K146 K147 F148
Binding residue
(residue number reindexed from 1)		V39 E42 N46 L47 C50 Q68 V69 K72 E73 D76 N80 G82 R83 T86 F90 K141 K142 F143
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process
GO:0043066 negative regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:2vm6, PDBe:2vm6, PDBj:2vm6
PDBsum2vm6
PubMed18812174
UniProtQ16548|B2LA1_HUMAN Bcl-2-related protein A1 (Gene Name=BCL2A1)

[Back to BioLiP]