Structure of PDB 2vkn Chain A Binding Site BS01

Receptor Information
>2vkn Chain A (length=66) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DNFIYKAKALYPYDADDDDAYEISFEQNEILQVSDIEGRWWKARRANGET
GIIPSNYVQLIDGPEE
Ligand information
>2vkn Chain C (length=9) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KPLPPLPLA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2vkn Structural Genomics of Yeast SH3 Domains
Resolution2.05 Å
Binding residue
(original residue number in PDB)		Y11 E22 R39 W40 P54 N56 Y57
Binding residue
(residue number reindexed from 1)		Y11 E22 R39 W40 P54 N56 Y57
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2vkn, PDBe:2vkn, PDBj:2vkn
PDBsum2vkn
PubMed
UniProtP40073|SHO1_YEAST High osmolarity signaling protein SHO1 (Gene Name=SHO1)

[Back to BioLiP]