Structure of PDB 2vju Chain A Binding Site BS01

Receptor Information

>2vju Chain A (length=129) Species: 210 (Helicobacter pylori) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AVLYKSNHNVVYSCKYHIVWCPKYRRKVLVGAVEMRLKEIIQEVAKELRV
EIIEMQTDKDHIHILADIDPSFGVMKFIKTAKGRSSRILRQEFNHLKTKL
PTLWTNSCFISTVGGAPLNVVKQYIENQQ

Ligand information

>2vju Chain C (length=35) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gaatcccctagctttagctatggggagtatgtcaa

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2vju Mechanism of is200/is605 Family DNA Transposases: Activation and Transposon-Directed Target Site Selection.
Resolution	2.4 Å
Binding residue (original residue number in PDB)	C24 K26 Y27 R28 H64 H66 M78 K82 K85 G86 R87 S89 R90 R93 T105 W107 N109 S110
Binding residue (residue number reindexed from 1)	C21 K23 Y24 R25 H61 H63 M75 K79 K82 G83 R84 S86 R87 R90 T102 W104 N106 S107

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004803	transposase activity
GO:0046872	metal ion binding

	Biological Process
GO:0006313	DNA transposition

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2vju, PDBe:2vju, PDBj:2vju
PDBsum	2vju
PubMed	18243097
UniProt	Q933Z0

[Back to BioLiP]