Structure of PDB 2v8c Chain A Binding Site BS01

Receptor Information
>2v8c Chain A (length=139) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMI
VGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNV
AVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2v8c High-Resolution Structural Analysis of Mammalian Profilin 2A Complex Formation with Two Physiological Ligands: The Formin Homology 1 Domain of Mdia1 and the Proline-Rich Domain of Vasp.
Resolution1.98 Å
Binding residue
(original residue number in PDB)
W3 Y6 N9 Y29 W31 M130 Y133 F139
Binding residue
(residue number reindexed from 1)
W3 Y6 N9 Y29 W31 M130 Y133 F139
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0003785 actin monomer binding
GO:0005515 protein binding
GO:0005546 phosphatidylinositol-4,5-bisphosphate binding
GO:0016887 ATP hydrolysis activity
Biological Process
GO:0010633 negative regulation of epithelial cell migration
GO:0030036 actin cytoskeleton organization
GO:0030837 negative regulation of actin filament polymerization
GO:0030838 positive regulation of actin filament polymerization
GO:0032233 positive regulation of actin filament bundle assembly
GO:0032781 positive regulation of ATP-dependent activity
GO:0033138 positive regulation of peptidyl-serine phosphorylation
GO:0044087 regulation of cellular component biogenesis
GO:0050804 modulation of chemical synaptic transmission
GO:0050821 protein stabilization
GO:0051496 positive regulation of stress fiber assembly
GO:0098885 modification of postsynaptic actin cytoskeleton
GO:0099140 presynaptic actin cytoskeleton organization
GO:0099171 presynaptic modulation of chemical synaptic transmission
GO:0110053 regulation of actin filament organization
GO:1900028 negative regulation of ruffle assembly
GO:2000300 regulation of synaptic vesicle exocytosis
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0098685 Schaffer collateral - CA1 synapse
GO:0098793 presynapse
GO:0098794 postsynapse
GO:0098978 glutamatergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2v8c, PDBe:2v8c, PDBj:2v8c
PDBsum2v8c
PubMed18001770
UniProtQ9JJV2|PROF2_MOUSE Profilin-2 (Gene Name=Pfn2)

[Back to BioLiP]