Structure of PDB 2v89 Chain A Binding Site BS01

Receptor Information
>2v89 Chain A (length=78) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCM
DLEERTLIHLSEGSNKYYCNEHVQIARA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2v89 Rag2 Phd Finger Couples Histone H3 Lysine 4 Trimethylation with V(D)J Recombination.
Resolution1.1 Å
Binding residue
(original residue number in PDB)		G1414 Y1415 T1436 A1442 M1443 I1444 Y1445 W1453 S1470 N1474
Binding residue
(residue number reindexed from 1)		G5 Y6 T27 A33 M34 I35 Y36 W44 S61 N65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006310 DNA recombination
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2v89, PDBe:2v89, PDBj:2v89
PDBsum2v89
PubMed18033247
UniProtP21784|RAG2_MOUSE V(D)J recombination-activating protein 2 (Gene Name=Rag2)

[Back to BioLiP]