Structure of PDB 2v88 Chain A Binding Site BS01

Receptor Information
>2v88 Chain A (length=78) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCM
DLEERTLIHLSEGSNKYYCNEHVQIARA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2v88 The Plant Homeodomain Finger of Rag2 Recognizes Histone H3 Methylated at Both Lysine-4 and Arginine-2.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		Y415 T436 K440 A442 M443 I444 Y445 W453 L469 S470 G472 N474
Binding residue
(residue number reindexed from 1)		Y6 T27 K31 A33 M34 I35 Y36 W44 L60 S61 G63 N65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006310 DNA recombination
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2v88, PDBe:2v88, PDBj:2v88
PDBsum2v88
PubMed18025461
UniProtP21784|RAG2_MOUSE V(D)J recombination-activating protein 2 (Gene Name=Rag2)

[Back to BioLiP]