Structure of PDB 2v83 Chain A Binding Site BS01

Receptor Information
>2v83 Chain A (length=71) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEE
RTLIHLSEGSNKYYCNEHVQI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2v83 The Plant Homeodomain Finger of Rag2 Recognizes Histone H3 Methylated at Both Lysine-4 and Arginine-2.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		Y415 S435 T436 A442 M443 Y445 W453 L466 L469 S470 N474
Binding residue
(residue number reindexed from 1)		Y2 S22 T23 A29 M30 Y32 W40 L53 L56 S57 N61
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006310 DNA recombination
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2v83, PDBe:2v83, PDBj:2v83
PDBsum2v83
PubMed18025461
UniProtP21784|RAG2_MOUSE V(D)J recombination-activating protein 2 (Gene Name=Rag2)

[Back to BioLiP]