Structure of PDB 2v27 Chain A Binding Site BS01

Receptor Information

>2v27 Chain A (length=264) Species: 167879 (Colwellia psychrerythraea 34H)

GTKYVSKVPDEHGFIEWSTEENLIWQELFTRQIACIKDKACDEYHEGLAK
LNLPTDRIPQLDEVSKVLKVSTGWECYPVPALIGFGEFFRLLSEKKFPVA
TFIRSREEMDYLQEPDIFHEIFGHCPLLTNSSFANYTEAYGKMGLNATKE
QRVFLARLYWFTIEFGLLDTPKGLRIYGGGVLSSPGETDYAMNNTDVDRK
PFDILDVLRTPYRIDIMQPIYYMLTKVSDLDEIRKFEVDDIMELVAQAEA
LGLHEAKFPVKKAS

Ligand information

• Ligand ID: FE
• InChI: InChI=1S/Fe/q+3
• InChIKey: VTLYFUHAOXGGBS-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  CACTVS 3.341
  OpenEye OEToolkits 1.5.0: [Fe+3]
• Formula: Fe
• Name: FE (III) ION
• DrugBank: DB13949
• PDB chain: 2v27 Chain A Residue 1268

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2v27 Structure of Phenylalanine Hydroxylase from Colwellia Psychrerythraea 34H, a Monomeric Cold Active Enzyme with Local Flexibility Around the Active Site and High Overall Stability.
• Resolution: 1.5 Å
• Binding residue (original residue number in PDB): H122 H127 E167
• Binding residue (residue number reindexed from 1): H119 H124 E164
• Annotation score: 1

Enzymatic activity

• Catalytic site (original residue number in PDB): H122 H127 E167 S186
• Catalytic site (residue number reindexed from 1): H119 H124 E164 S183
• Enzyme Commision number: 1.14.16.1: phenylalanine 4-monooxygenase.

Gene Ontology

Molecular Function

• GO:0004497 monooxygenase activity
• GO:0004505 phenylalanine 4-monooxygenase activity
• GO:0005506 iron ion binding
• GO:0016714 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
• GO:0046872 metal ion binding

Biological Process

• GO:0006559 L-phenylalanine catabolic process
• GO:0009072 aromatic amino acid metabolic process
• GO:0019293 tyrosine biosynthetic process, by oxidation of phenylalanine

External links

• PDB: RCSB:2v27, PDBe:2v27, PDBj:2v27
• PDBsum: 2v27
• PubMed: 17537732
• UniProt: Q47XN7