Structure of PDB 2v1t Chain A Binding Site BS01

Receptor Information
>2v1t Chain A (length=73) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQP
QQLLQVLQQTLPPPVFQMLLTKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2v1t Tom20 Recognizes Mitochondrial Presequences Through Dynamic Equilibrium Among Multiple Bound States.
Resolution1.92 Å
Binding residue
(original residue number in PDB)		F70 I74 E78 E79 C100 Q102 L106 V109 L110
Binding residue
(residue number reindexed from 1)		F17 I21 E25 E26 C47 Q49 L53 V56 L57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006605 protein targeting
GO:0006886 intracellular protein transport
Cellular Component
GO:0005742 mitochondrial outer membrane translocase complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2v1t, PDBe:2v1t, PDBj:2v1t
PDBsum2v1t
PubMed17948058
UniProtQ62760|TOM20_RAT Mitochondrial import receptor subunit TOM20 homolog (Gene Name=Tomm20)

[Back to BioLiP]