Structure of PDB 2v1r Chain A Binding Site BS01

Receptor Information
>2v1r Chain A (length=67) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPSKLEFARALYDFVPENPEMEVALKKGDLMAILSKKDPLGRDSDWWKVR
TKNGNIGYIPYNYIEII
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2v1r Structural Genomics of Yeast SH3 Domains
Resolution2.1 Å
Binding residue
(original residue number in PDB)
R18 I76
Binding residue
(residue number reindexed from 1)
R9 I67
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2v1r, PDBe:2v1r, PDBj:2v1r
PDBsum2v1r
PubMed
UniProtP80667|PEX13_YEAST Peroxisomal membrane protein PEX13 (Gene Name=PEX13)

[Back to BioLiP]