Structure of PDB 2rvn Chain A Binding Site BS01

Receptor Information
>2rvn Chain A (length=83) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMGKKTKRTADSSSSEDEEEYVVEKVLDRRMVKGQVEYLLKWKGFSEE
HNTWEPEKNLDCPELISEFMKKYKKMKEGENNK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2rvn Extended string-like binding of the phosphorylated HP1 alpha N-terminal tail to the lysine 9-methylated histone H3 tail
ResolutionN/A
Binding residue
(original residue number in PDB)
E19 Y20 V21 W41 F44
Binding residue
(residue number reindexed from 1)
E22 Y23 V24 W44 F47
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2rvn, PDBe:2rvn, PDBj:2rvn
PDBsum2rvn
PubMed26934956
UniProtQ61686|CBX5_MOUSE Chromobox protein homolog 5 (Gene Name=Cbx5)

[Back to BioLiP]