Structure of PDB 2rui Chain A Binding Site BS01

Receptor Information

>2rui Chain A (length=158) Species: 260799 (Bacillus anthracis str. Sterne) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GSHMDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKN
LLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDN
ENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGD
LVGTKAKK

Ligand information

>2rui Chain B (length=4) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LPAT

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2rui Structure of the Bacillus anthracis Sortase A Enzyme Bound to Its Sorting Signal: A FLEXIBLE AMINO-TERMINAL APPENDAGE MODULATES SUBSTRATE ACCESS.
Resolution	N/A
Binding residue (original residue number in PDB)	S59 V110 A124 G125 H126 P168 K170 W171 I185 C187 R196
Binding residue (residue number reindexed from 1)	S7 V58 A72 G73 H74 P116 K118 W119 I133 C135 R144

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:2rui, PDBe:2rui, PDBj:2rui
PDBsum	2rui
PubMed	26324714
UniProt	Q81V16

[Back to BioLiP]