Structure of PDB 2ru3 Chain A Binding Site BS01

Receptor Information
>2ru3 Chain A (length=103) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSTNAEPVVGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVIT
DRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRT
NVQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ru3 RBFOX and SUP-12 sandwich a G base to cooperatively regulate tissue-specific splicing
ResolutionN/A
Binding residue
(original residue number in PDB)		K36 F38 G40 G41 L42 P43 Y44 I67 D69 R70 R76 Y78 F80 R103 N106 N108 A110 G113 A114 K115 R117
Binding residue
(residue number reindexed from 1)		K18 F20 G22 G23 L24 P25 Y26 I49 D51 R52 R58 Y60 F62 R85 N88 N90 A92 G95 A96 K97 R99
Binding affinityPDBbind-CN: Kd=565nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:2ru3, PDBe:2ru3, PDBj:2ru3
PDBsum2ru3
PubMed25132178
UniProtO45189

[Back to BioLiP]