Structure of PDB 2rsn Chain A Binding Site BS01

Receptor Information
>2rsn Chain A (length=75) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVSVKPLPDIDSNEGETDADVYEVEDILADRVNKNGINEYYIKWAGYDWY
DNTWEPEQNLFGAEKVLKKWKKRKK
Ligand information
>2rsn Chain B (length=18) Species: 4896 (Schizosaccharomyces pombe) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ARTKQTARKSTGGKAPRY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2rsn Intrinsic nucleic Acid-binding activity of chp1 chromodomain is required for heterochromatic gene silencing
ResolutionN/A
Binding residue
(original residue number in PDB)		D20 V21 Y22 E23 V24 E25 W44 Y47 D51 E55 N59 G62 A63 K65
Binding residue
(residue number reindexed from 1)		D20 V21 Y22 E23 V24 E25 W44 Y47 D51 E55 N59 G62 A63 K65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042393 histone binding
GO:0140566 histone reader activity

View graph for
Molecular Function
External links
PDB RCSB:2rsn, PDBe:2rsn, PDBj:2rsn
PDBsum2rsn
PubMed22727667
UniProtQ10103|CHP1_SCHPO Chromo domain-containing protein 1 (Gene Name=chp1)

[Back to BioLiP]