Structure of PDB 2rs2 Chain A Binding Site BS01

Receptor Information
>2rs2 Chain A (length=84) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFM
DQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2rs2 Structure of Musashi1 in a complex with target RNA: the role of aromatic stacking interactions
ResolutionN/A
Binding residue
(original residue number in PDB)		K21 F23 G26 S28 W29 M52 R61 G62 F63 F65 K88 D91 K93 A95 F96 R98 R99 A100
Binding residue
(residue number reindexed from 1)		K2 F4 G7 S9 W10 M33 R42 G43 F44 F46 K69 D72 K74 A76 F77 R79 R80 A81
Enzymatic activity
Catalytic site (original residue number in PDB) Q42
Catalytic site (residue number reindexed from 1) Q23
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:2rs2, PDBe:2rs2, PDBj:2rs2
PDBsum2rs2
PubMed22140116
UniProtQ61474|MSI1H_MOUSE RNA-binding protein Musashi homolog 1 (Gene Name=Msi1)

[Back to BioLiP]