Structure of PDB 2rra Chain A Binding Site BS01

Receptor Information
>2rra Chain A (length=99) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSSGSSGNRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYD
QQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2rra Structural basis for the dual RNA-recognition modes of human Tra2-beta RRM.
ResolutionN/A
Binding residue
(original residue number in PDB)		R111 F123 G124 G160 F161 F163 Y165 R187 R188 R190 D192 S194 I195 T196 K197 R198
Binding residue
(residue number reindexed from 1)		R9 F21 G22 G58 F59 F61 Y63 R85 R86 R88 D90 S92 I93 T94 K95 R96
Binding affinityPDBbind-CN: Kd=1.5uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:2rra, PDBe:2rra, PDBj:2rra
PDBsum2rra
PubMed20926394
UniProtP62995|TRA2B_HUMAN Transformer-2 protein homolog beta (Gene Name=TRA2B)

[Back to BioLiP]