Structure of PDB 2rqu Chain A Binding Site BS01

Receptor Information

>2rqu Chain A (length=61) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGV
FPVSFVHILSD

Ligand information

>2rqu Chain B (length=19) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

CIISAMPTKSSRKAKKPAQ

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2rqu Structural basis of the recognition of the SAMP motif of adenomatous polyposis coli by the Src-homology 3 domain.
Resolution	N/A
Binding residue (original residue number in PDB)	I1075 Y1076 D1077 Q1079 D1081 N1082 D1084 E1085 E1090 D1101 E1103 W1104 V1118 F1123
Binding residue (residue number reindexed from 1)	I7 Y8 D9 Q11 D13 N14 D16 E17 E22 D33 E35 W36 V50 F55

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005096	GTPase activator activity

	Biological Process
GO:0043547	positive regulation of GTPase activity

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2rqu, PDBe:2rqu, PDBj:2rqu
PDBsum	2rqu
PubMed	20509626
UniProt	Q9ULH1\|ASAP1_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (Gene Name=ASAP1)

[Back to BioLiP]