Structure of PDB 2rqc Chain A Binding Site BS01

Receptor Information
>2rqc Chain A (length=115) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSSGSSGLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFG
NVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQ
LKRSKNDSKSGPSSG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2rqc Structural basis for the sequence-specific RNA-recognition mechanism of human CUG-BP1 RRM3
ResolutionN/A
Binding residue
(original residue number in PDB)		Q394 F404 Y406 Q410 S429 A430 K431 F433 I434 K436 K442 F446 S448 K473 K477 R478
Binding residue
(residue number reindexed from 1)		Q19 F29 Y31 Q35 S54 A55 K56 F58 I59 K61 K67 F71 S73 K98 K102 R103
Binding affinityPDBbind-CN: Kd=1.9uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:2rqc, PDBe:2rqc, PDBj:2rqc
PDBsum2rqc
PubMed19553194
UniProtQ92879|CELF1_HUMAN CUGBP Elav-like family member 1 (Gene Name=CELF1)

[Back to BioLiP]