Structure of PDB 2rpq Chain A Binding Site BS01

Receptor Information
>2rpq Chain A (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCER
QGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2rpq Structure of the small ubiquitin-like modifier (SUMO)-interacting motif of MBD1-containing chromatin-associated factor 1 bound to SUMO-3
ResolutionN/A
Binding residue
(original residue number in PDB)		E4 N15 H17 V30 Q31 F32 K33 I34 K35 H37 T38 K42 R50
Binding residue
(residue number reindexed from 1)		E4 N15 H17 V30 Q31 F32 K33 I34 K35 H37 T38 K42 R50
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0031386 protein tag activity
GO:0031625 ubiquitin protein ligase binding
GO:0044389 ubiquitin-like protein ligase binding
Biological Process
GO:0016925 protein sumoylation
GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0016605 PML body

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2rpq, PDBe:2rpq, PDBj:2rpq
PDBsum2rpq
PubMed18842587
UniProtP61956|SUMO2_HUMAN Small ubiquitin-related modifier 2 (Gene Name=SUMO2)

[Back to BioLiP]