Structure of PDB 2rpn Chain A Binding Site BS01

Receptor Information
>2rpn Chain A (length=59) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APWATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLF
PSNYVSLGN
Ligand information
>2rpn Chain B (length=18) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AKKTKPTPPPKPSHLKPK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2rpn Structural, functional, and bioinformatic studies demonstrate the crucial role of an extended peptide binding site for the SH3 domain of yeast Abp1p
ResolutionN/A
Binding residue
(original residue number in PDB)		Y8 D9 Y10 E14 N16 E17 D33 D35 W36 N53 Y54
Binding residue
(residue number reindexed from 1)		Y8 D9 Y10 E14 N16 E17 D33 D35 W36 N53 Y54
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2rpn, PDBe:2rpn, PDBj:2rpn
PDBsum2rpn
PubMed19590096
UniProtP15891|ABP1_YEAST Actin-binding protein (Gene Name=ABP1)

[Back to BioLiP]