Structure of PDB 2ror Chain A Binding Site BS01

Receptor Information
>2ror Chain A (length=138) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSSGSSGKAEAEQNWWEGPPQDLSVHLWYAGPMERAGAESILANRSDGTF
LVRQRVKDAAEFAISIKYNVEVKHIKIMTAEGLYRITEKKAFRGLTELVE
FYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRSGPSSG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ror Solution structure of the VAV1 SH2 domain complexed with a tyrosine-phosphorylated peptide from SLP76
ResolutionN/A
Binding residue
(original residue number in PDB)
R53 R55 K73 H74 I75 K76 D109 C110 F111 K112
Binding residue
(residue number reindexed from 1)
R53 R55 K73 H74 I75 K76 D109 C110 F111 K112
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2ror, PDBe:2ror, PDBj:2ror
PDBsum2ror
PubMed
UniProtP15498|VAV_HUMAN Proto-oncogene vav (Gene Name=VAV1)

[Back to BioLiP]