Structure of PDB 2rol Chain A Binding Site BS01

Receptor Information
>2rol Chain A (length=64) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSMGTAGKWVLCNYDFQARNSSELSVKQRDVLEVLDDSRKWWKVRDPAGQ
EGYVPYNILTPYPG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2rol Structural basis of PxxDY motif recognition in SH3 binding
ResolutionN/A
Binding residue
(original residue number in PDB)
S495 R512 W514 Y526 N530
Binding residue
(residue number reindexed from 1)
S22 R39 W41 Y53 N57
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2rol, PDBe:2rol, PDBj:2rol
PDBsum2rol
PubMed18644376
UniProtQ8TE68|ES8L1_HUMAN Epidermal growth factor receptor kinase substrate 8-like protein 1 (Gene Name=EPS8L1)

[Back to BioLiP]