Structure of PDB 2rod Chain A Binding Site BS01

Receptor Information
>2rod Chain A (length=162) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRR
VGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVTNWGRIV
TLISFGAFVAKHLKSVNQESFIEPLAETITDVLVRTKRDWLVKQRGWDGF
VEFFHVQDLEGG
Ligand information
>2rod Chain B (length=27) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AELPPEFAAQLRKIGDKVYCTWSAPDM
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2rod Structure of the BH3 Domains from the p53-Inducible BH3-Only Proteins Noxa and Puma in Complex with Mcl-1
ResolutionN/A
Binding residue
(original residue number in PDB)		R196 V201 H205 M212 K215 L216 D217 S226 V230 H233 V234 N241 G243 R244 T247 F251 F299 F300 Q303
Binding residue
(residue number reindexed from 1)		R50 V55 H59 M66 K69 L70 D71 S80 V84 H87 V88 N95 G97 R98 T101 F105 F153 F154 Q157
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:2rod, PDBe:2rod, PDBj:2rod
PDBsum2rod
PubMed18589438
UniProtP97287|MCL1_MOUSE Induced myeloid leukemia cell differentiation protein Mcl-1 homolog (Gene Name=Mcl1)

[Back to BioLiP]