Structure of PDB 2rny Chain A Binding Site BS01

Receptor Information
>2rny Chain A (length=121) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYF
DIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYK
FCSKLAEVFEQEIDPVMQSLG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2rny Structural Basis of Site-Specific Histone Recognition by the Bromodomains of Human Coactivators PCAF and CBP/p300
ResolutionN/A
Binding residue
(original residue number in PDB)		L1119 L1120 I1122 A1164 N1168 S1172 R1173 F1177
Binding residue
(residue number reindexed from 1)		L43 L44 I46 A88 N92 S96 R97 F101
Enzymatic activity
Enzyme Commision number 2.3.1.-
2.3.1.48: histone acetyltransferase.
Gene Ontology
Molecular Function
GO:0004402 histone acetyltransferase activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2rny, PDBe:2rny, PDBj:2rny
PDBsum2rny
PubMed18400184
UniProtQ92793|CBP_HUMAN CREB-binding protein (Gene Name=CREBBP)

[Back to BioLiP]